PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g062780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 316aa    MW: 34650.8 Da    PI: 9.1407
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g062780.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-18159213256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Csa04g062780.1 159 RKKLRLSKEQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 213
                     788899***********************************************98 PP

2HD-ZIP_I/II123.51e-39159248191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr +l
  Csa04g062780.1 159 RKKLRLSKEQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELR-AL 248
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.7E-331123IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.9E-19137213IPR009057Homeodomain-like
SuperFamilySSF466891.5E-18143216IPR009057Homeodomain-like
PROSITE profilePS5007117.232155215IPR001356Homeobox domain
SMARTSM003894.8E-15157219IPR001356Homeobox domain
CDDcd000864.76E-15159216No hitNo description
PfamPF000468.9E-16159213IPR001356Homeobox domain
PROSITE patternPS000270190213IPR017970Homeobox, conserved site
SMARTSM003402.9E-26215258IPR003106Leucine zipper, homeobox-associated
PfamPF021831.6E-11215249IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0009725Biological Processresponse to hormone
GO:0010218Biological Processresponse to far red light
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGERDDGLGL SLSLGNSQLK EPSLRLNLMP FTASTSSSFP HMHNQINNSH PQKIHHNSWT  60
HLFQSSGIKR TTAERNSDAG SFLRGFDVNR AASSVPVVNL EEEAAVVSSP NSTVSSLSGN  120
KRDLAAARGG GEEHEAERAS CSHGGGSDDE DCGNGDGSRK KLRLSKEQAL VLEETFKEHS  180
TLNPKQKLAL AKQLNLRARQ VEVWFQNRRA RTKLKQTEVD CEYLKRCCDN LTEENRRLQK  240
EVSELRALKL SPHLYMHMTP PTTLTMCPSC ERVSSSASAN VTAAPPPATV VGRPSPQRST  300
LWTAISLQQV QRSGR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157163SRKKLRL
2207215RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935890.0AB493589.1 Arabidopsis thaliana At2g44910 mRNA for hypothetical protein, partial cds, clone: RAAt2g44910.
GenBankAJ4412510.0AJ441251.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein ATHB4 (Athb4 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506430.10.0PREDICTED: homeobox-leucine zipper protein ATHB-4-like isoform X1
SwissprotP929531e-175ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLR0FX190.0R0FX19_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__2679__AT2G44910.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.11e-124homeobox-leucine zipper protein 4